-
- Pet Toy balls
- Model Number: JVT-0344 Brand Name: Joyee Key Specifications/Special Features: Material: VinylSize: 4'Packing: each with a hang tag Shipping Information: FOB Port: Shenzhen Lead Time: 40 - 45 ...
JunMax Industrial Co., Ltd [Verified]
-
- Promotional Pet Toys, Made of Plastic, OEM Orders are Welcome
- Model Number: plastic pet toy-006F Brand Name: Jiaxing Key Specifications/Special Features: Material: plastic or customizedCustomized sizes, colors and logos are acceptedMade of safety materialNon-toxic and tasteless, easy to wash, odorlessEco-f...
Jinjiang Jiaxing Groups Co. Ltd [Verified]
-
- Fashionable Plastic Pet ID Tag, Clients' Logo Can be Print on It, OEM Orders Welcomed
- Model Number: JJ-PPT-#2565 Brand Name: JIAN Key Specifications/Special Features: Material: plastic + PVC cover + paperID card Size: 25 x 25mmWe can print logo according to clients' requests.Products can meet EN-71/ CPSIA/ Prop.65-standardOEM o...
Dongguan Jian Plastic & Metal Products Ltd [Verified]
-
- Leather factory supply high quality genuine leather braided dog leash
- Model Number: LFSH20161208001 Brand Name: Janyo Key Specifications/Special Features: Material: genuine leatherSize:Collar: 2.0cm*50cmLeash: 1.8cm*90cmColor: brownSample lead time: 5-7 daysProduction lead time: 30-45 daysOEM/ODM services are prov...
-
- Dog Leash, Made of Polyester with Satin
- Model Number: JSGL-DogLeash06 Key Specifications/Special Features: Dog leash and dog collarCustomized designs are welcomeMaterials: polyester with satinLogos: screen printingSize: 1.5/2 x 120/180cmFitting: zinc alloy carabiner hookMOQ: 100pcsDel...
JOJO Fashion Accessories Co. Ltd [Verified]
-
- Automatic Cool Pet Pad, Ice Pet Mat,Cat Ice Mat made in Shanghai
- Model Number: 5BF-BD008 Brand Name: BingFan Key Specifications/Special Features: Reusable cold productsCan put in freezer or use directlyNontoxic, non-caustic DescriptionCOOL MATFactory advantageYou can customize whatever size you want ...
Shanghai Bingfan Industrial Co. Ltd [Verified]
-
- Pet Clothes, Keep Body Warm, Customized Colors Welcomed
- Model Number: Pet clothes-r77F Brand Name: Jiaxing Key Specifications/Special Features: Features:Material: acrylic or customizedVery breathable and very lightSoft texture, comfortableKeep its body warmKeep your pet clean and drySizes: S, M, L ...
Jinjiang Jiaxing Groups Co. Ltd [Verified]
-
- New Pet Cookies Treat for Cannies
- Model Number: CC-32 Key Specifications/Special Features: Guaranteed analysis:Crude protein (min) 5.0%Crude fat (min) 4.0%Crude fiber (max) 4.0%Moisture (max) 28.0%Calories:3.5 calories per treatIngredients:Pumpkin, oatmeal, ground brown rice, ta...
Jinjiang Jiaxing Shoes & Garments Co. Ltd [Verified]
-
- Cat cooler ice mat for pet
- Model Number: cooling mat-3Bingfan-BD071 Brand Name: Bingfan Key Specifications/Special Features: Outer material: nylonInner liquid: CMC + glycerol + waterHS code: 3824999990Certifications: CE, SGS, FDS, MSDS, ISO 9001, BSCISize: 51*41*1cmColo...
Shanghai Bingfan Industrial Co. Ltd [Verified]
-
- PU Velvet Boat Shaped Oval Pet Bed
- Model Number: COO-2029-2 Brand Name: COOBY PET Key Specifications/Special Features: Item name: PU velvet boat shaped oval pet bedSizes: 60*40*23/70*50*25/80*60*27cmColors: red/blueMaterials: PU leather/Oxford/short velvet/soft velveteenFilling: ...
Dosun Electronics Co. Ltd [Verified]
-
- High Quality Floating Fish Feed Pellet for Catfish
- Model Number: animal feed Brand Name: yatai Key Specifications/Special Features: Directions for Use1.Accordingtogrowthcycledeterminefeedingfeedtype,inordertomeetthecatfishdifferentgrowthstagesofnutritionalrequirements.2.Do"timing,point,quantitat...
Cangzhou Yatai Commercial & Trade Co . Ltd [Verified]
-
- 100% new material factory best price round shape fish farming tank for home decoration
- Model Number: SSYG-004 Brand Name: sunsee Key Specifications/Special Features: Specifications:1. Wholesale2. Top grade acrylic3. Environment-friendly4. Very fashionable and beautiful5. Excellent weather fastPacking:EPE, polybag, paper carton, wo...
Ningbo Sunsee Acrylic Industry Co. Ltd [Verified]
-
- Cat Tree in Various Color Combinations, Measures 66x60x125cm, Easy to Assemble
- Model Number: Tree 95 Brand Name: Senful Pet. Petcomer Key Specifications/Special Features: Allows cat to express natural instincts without causing damage to furnitureStylish color combinationEasy to assemble by following instructionCozy plush s...
Yiwu Senye IMP&EXP Co.,Ltd [Verified]
-
- Dog chains
- Model Number: cord outdoor bracelets-A32-#0165 Brand Name: Dog chains Key Specifications/Special Features: Hot selling parachute cord braided braceletsSmall and OEM orders are welcomePackaging:Material: PP and polyester cord, nylonProduct length...
Zhejiang Best Idea Promotion Items Co., Ltd [Verified]
-
- Premium Bleached Rawhide Pressed Bones with Chicken Meat Wrapped
- Model Number: BP105-#8735 Key Specifications/Special Features: These chewy snacks make a delicious addition to your dog's daily meals. Our bleached pressed bones with chicken wrap are made from 100% crunchy beef rawhide, which is low artificia...
Jinjiang Jiaxing Shoes & Garments Co. Ltd [Verified]
-
- Leash Type and Eco-Friendly Feature Standard Leather Dog Collar
- Model Number: WF-G1-LXF0040 Brand Name: Well faith Key Specifications/Special Features: 2016 hot selling wholesale LED dog collar for safety walkingUK/US/AU plug powered for Christmas lights, wholesale item fairy light, flexible, customized, m...
-
- Design layer chicken cages
- Model Number: XINHAI design layer chicken cages Brand Name: XINHAI Key Specifications/Special Features: 3-tierwith 6 cages per set galvanized surface treatment, for anti-rust, long time service lifeAutomatic watering systemSize: 1.88*2.15*1.5m a...
Zibo Hans International Co. Ltd [Verified]
-
- 2.5"-5" 9g-19g Mint Flavor, Edible Puppy Dental Chews, Twist Hollow Stick Chew
- Model Number: EDC-090 Key Specifications/Special Features: Type:Pet foodApplication:DogsFeature:Eco-Friendly, stockedPlace of origin: Jiangxi, China (Mainland)Brand name:OEMPacking:120g/bag 240g/bagPackaging:Printed polybagsShelf life:24 monthsC...
Jinjiang Jiaxing Shoes & Garments Co. Ltd [Verified]
-
- PU Leather Pet Collars, Fashion, Cheap Quality, with Bandanas
- Model Number: RS-PT-25 Brand Name: Remind Sunny Key Specifications/Special Features: Product name:leather collarMaterial: PUSize: 1.5*40cmWeight: 25gPacking: 120pcs/ctnColors: pink/black/red/yellow/blueOEM & ODM: customized logos and desig...
Fuzhou Remind Sunny Imp&Exp Co., Ltd. [Verified]
-
- LED aquarium light, dimmable, high flux and penetration shine deeper into the tank
- Model Number: YGL-SZLED500A5-#445-#4483 Brand Name: EXCEED Key Specifications/Special Features: Special features:Used in bedroom, clubs to createthe cozyand sweet environment16 different colors and 4 setting modes for option to change the color ...
Exceed Electronic Co. Ltd [Verified]
Top Search This Week
- 11timeswine
New Products
-
Yellow Sticky Trap in Shapes
price: Negotiable
-
Biodegradable Insect Sticky Trap
price: Negotiable
-
Insect Sticky Trap And Pheromone
price: Negotiable



